PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01083.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 233aa    MW: 26447 Da    PI: 8.8592
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01083.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT eEd++l d+v+ +G g+W++Ia++ g++R++k+c++rw +yl
  Rsa1.0_01083.1_g00007.1 14 KGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL 61
                             678*******************************************97 PP

2Myb_DNA-binding60.14.7e-1967112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T +E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l
  Rsa1.0_01083.1_g00007.1  67 RGNFTDQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.492961IPR017930Myb domain
SuperFamilySSF466893.45E-3112108IPR009057Homeodomain-like
SMARTSM007172.9E-151363IPR001005SANT/Myb domain
PfamPF002497.3E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-251568IPR009057Homeodomain-like
CDDcd001671.17E-121761No hitNo description
PROSITE profilePS5129427.58362116IPR017930Myb domain
SMARTSM007172.1E-1866114IPR001005SANT/Myb domain
PfamPF002497.6E-1867112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-2769116IPR009057Homeodomain-like
CDDcd001673.78E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MRMIRDEKDQ EYKKGLWTVE EDKILMDYVR THGQGHWNRI AKKTGLKRCG KSCRLRWMNY  60
LSPSVNRGNF TDQEEDLIIR LHKLLGNRWS LIAKRVPGRT DNQVKNYWNT HLSKKLGLGD  120
HSYAANPACG TETPASMVIA KTKTSSPPSL VVTTTTTSPS HQDVGDEKVS TLRSDSTDEN  180
SKLNTKSKPV YSIQPDVEVA ATIPNLFDTF WVLEDNFDLS SLTMMDFANG YCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196311e-151AY519631.1 Arabidopsis thaliana MYB transcription factor (At5g40330) mRNA, complete cds.
GenBankBT0252851e-151BT025285.1 Arabidopsis thaliana At5g40330 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139990.11e-162PREDICTED: transcription factor MYB23
RefseqXP_013746800.11e-162PREDICTED: transcription factor MYB23-like
SwissprotQ962761e-131MYB23_ARATH; Transcription factor MYB23
TrEMBLM4E9Y21e-156M4E9Y2_BRARP; Uncharacterized protein
STRINGBra025589.1-P1e-155(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.11e-128myb domain protein 23